1881-09-01; Saline Observer |
Previous | 1 of 4 | Next |
|
small (250x250 max)
medium (500x500 max)
large ( > 500x500)
Full Resolution
|
This page
All
Subset
|
Loading content ...
?
rs"
*ftnnap^j
iNKI&M,OFiYHH,B^
ICOVEREK OF
Jfl!
pg COMPOBTO
IPosStlre Cnre
J Complaint, and Weafc,essA
Ir best female population. ^
l^-f ?*? ima°* Peiaa*8 Com.
pc-es,isaaininabaa and nip-lr
libeeasent^ andthe eonsequeS
J is paxncalarlj adapted^gj
[expe: tamora fram the uterna f n
l^ps-teat. Tha tendencxto can
-evestreainess ofthe stoaa^
Jj-oehes, Ifervcras lustration
■jffirssEess, Sepressloa, and Ihai"
|i=? dawn, causing pain, -nreirfit
%pc-npsBssily cured byits •£*.
. paerail eirenn-stoee&actin
tiat govern the fex-ale systg^
■yoiaj-Iaists cf either sex this
l.ik*S TE6ETABXE COX.
it SB aad 23S Western Avenue
IbiSboeifisfor^i. Sentbxioaa
■si is. tke farm of lozenges, on
Ifccs foreitier. MraPmSam
Hc^inqpiry. Send for pamph.
. ^.?n.;a.i tsis -Ripen,
hrithontLTDIAE. PISEHA3PS
furs cccsSpagon, biliousness
rtr. £5 eantsuer ba&
pH!IE8iC3.,Ciiic8|o,Ili
BT DKCSSISTS.
jlfij
IFUL If "
the LITER, ROWELS]
15 at-the saate time.
M; &a s?3tem of thepoison-
|rel-p9 iu Eidaey ar.a Urt- g
;uszeES, uasadaae, Caisti- "
. Sbesaatsra, _Tearaigi3,
i £2i SKiCe Complaints.
"SSOSLESAT:
-J »-:::?:i-:a City, Kansas,
''*■ i !:<-; ifter rejalar Phy-
'JSfcrfi1 ar years.
v? Washicirt?!!, C'Mo, says
I t » d*9 l-y fvar prominent
l.e »5es a'Ji-rwards oared by
hneili;."!:;, Chorion, Ohio
J-j.t-.l t:? ;t-, teh;,r Moated
|s!.:vy-V.,.:tt-:reili*m.
.."tl: Satan, X. T., says
..--'itf fr':::> uiiitsey troubles
I;u3 v.aj esjeil by tlie ass of
bf J*:-.;k<-rp. Tesn., .-offered
f i^iti iJidney troubles and
J-e.s or o:-er medicines,"
J -' '--S-aeiy Center, Vt,
|t7it?: k.-spt diJBauilj- and
Ii.:aney-v7ort isaja mm
"*NTLY CURES
[EASES,
R COMPLAINTS.
I and Piles.
Bry Testable ?»na in
a-1 ^^"-Jit?2^****-^ Quarts SS
a ia<ju!sj Form, Tery Con- £*
E9 tistr- cacnos reaaiiy pre- ^
bs ^SsfssiTir fc ei.'.to- /orn:.!
krSGISTS. PiUCE. $1.00 j
IBBS05& Co.. Prep's,
fe-paii) Bnt£156T<Hr„TT.
| "Dcm&Ia
i. Hullet
■=--=.-=««!. CIOTM
gaoame xfcat Beat tb*
' -^flt^ ^onltori Jr.,
, g'lte Ashland Clover
-Holler* ia a scientific tot
j "*,fcs"r^**i'.O..I'air.Se3t.
i I----2 ana IS-.ij, iya_ ^ ^
' *?*^~t""ecf80,000ranaer»
I iax-a "Victor-, .q!<i last rear
Hagerstawn, BTd.
\TEED \ssr». **!*rni
*Li3/*;
/ft— 2
■^/Srr.PSR HOUR.
SEHOFCRCATALOGUE.
' Jl_US' JND,'fi-MA-
\ n-p g»rsr.- r.f -* p^iploj-meni
_ _ -EgQueenCIta
|r>porter-xf •/_■. Simple outfit
Tj-SUBpeniler Co..Cji., a
|SEflTS¥/Af*TEO-90 fa^t
*.s^^*L**70""a'"l««MpI-Kif'r«ffi,.
ly ia a very
le acting oa
I, prottacingr»
|jns fov a com-
-cent postage.
is,
altLcaore, 313.
Iwp-C**^*
Ifc'
^
fe
K'
1
i /
k-S
u.
Il'i/I rc'-'a wh'/ willtaka
■P wPf'ks ma/ \)t r-etorei
ng jp po-*8iWp. Rent b»
JBangor, Mt. *
>« V« AND ROCK
• . ..'''ii-1 fe'B'la of WrT
JAN. TIFFIK, OHIO,
■wanted a payi;iSr stsua-
1-wagers.JaaesvlIlf., Wis.
|**« Watoasli av.0fflea2a.
J B.Bies Prices wduaS
J-C*.. CWcag.„ m "u
l*v?r', «h»«e*« K*w
leFut/g Co..Tol«do,o.
K5' WMfED
Irs
sjs
f&rxmrxgjsws,
^titertisemetit
/
!' 'J?!-*!, \. m »
?*K^^-^
-, t««*is;„,-,--_-.,'-^
j^y '^j^TaiiX^jjiii^M^igj*E^«i^'***;1
" J ■"•**■ V\ -" ■ J-"'"' ? * *J"i A * Uft*' il
;mv
i5rj'*aj.
■»* r-
LE BARON & NISSLf, Proprietors.
SALINE, WASHTENAW COUNTY, MICHIGAN,.,SEPTEMBER 1, 1881.
.... ,-, ,&.■■■ . ■ . .
vol; I—NO. 4l
■*y
v:^
ti!fmMmimiwmp0R)Bwwii
NEWS SU^iABY.
Important -Intelligence from All Parts.
, Domestle.
T' v"*
roiJE ^loopSeepers connected with the
Citj- Gouncitof Omaha were arrested on the
;24thfor -violation of the High-License law.
The Council had. refus.ed to pass an ordi-
nance^ior, the issuing of licenses, and no
liquor-dealer had tendered the $1,000 fee.
Akecext rich find of silver about ten
miles from Dead wood was followed in forty-
eight hours* hv the creation'of West Virginia
City, the-'elec'tion of a Recorder, the settlement of 1,000 persons, and; the opening of
nine saloons and two faro banks. On the
fourth-day-a1 daily newspaper appeared. *
THKEE4ea6hsfrom diphtheria at a sum*
mer hotel at Andover, IT. "EL, scattered the
guests in'all directions.
Wexj>icn'ow:s" speculators estimate that
the corn crop.in..the United States will fall
below the-average by from 300,000,000 to
400,000, OOOTmshelsV
Ox the 24th a jewelry store at Atlantic
Gity, -2f.J..,,was robbed of goods-valued-at
§10,000 while -the proprietor was absent, lor
dinner.!' .
The Lagonia Iron Company, at Portland,
Me., has closed its rolling mills and gone
into liquidation.
Ls"somfrparts olJNew England it is stated
that the Qorn'-erop will be a- total failure
on account of theunse'asohable colcLweather.
The mental aberration which inspired a
Dr. Mel. cOstrander Jq commit suicide at
Pittston, Pa;,, ai.few days ago} is said-to
have been o\png to excessive smoking. The
suicide. w;a|v|n,.the habit of .^itting-.f or hours
puffing ^*rfitfeerscn'auifl.^ -supplied; with "the
strongest "plug-"itobacco. . ',.*
Ak omnibus which was conveying passen^
gers fro^th^'Y&hash Eailroadl t<? «Lexin*A"
ton, Si^tj aliohit.eight o'clock onithe evening
of the 25th was entered by four heavily-
armed masked, men," who robbed the passengers, five in niimhey-,- of all their money,
wf^chesand other-valuables, and then escaped.
The Chief ofthe Bureau of Statistics reports that the -value of the exports for the
year ended July 81, last, exceeded the value
of the imports' by $256,691,597. The excess
for the previous year was $171,750,150. The
excess during, the last year of the imports
over the exports of gold was $90,666,97'"';
during the previous year the excess was
$76,156,569. ' The-total values of imports of
merchandise during the twelve months ended July-31, "'last, were $637,724,475, and during the previous twelve.months,.if6SS,972,-
221. The total values of exports of merchandise for "the -twelve months ended* Jilly
31, 1880, were $855,722,371;, twelve months
ended July 30, last, $894,416,066.
HERfEY:Hn.i., an old gentleman of seventy-seven years, .a former resident of Day-
enporiT, Iowa, was decoyed by a gang of
-' biiilkd-Steerer's •"'. into- a room of a boarding-house at Hartford, Conn., a few days
ago, and died there from heart disease,
brought Ion. by fright on discovering the
character, of his surroundings. One account
says he was swindled "out of fifty dollars,
and became So& excited that he lost his life-
Five of the swindlers were jailed on suspicion of murder.
A mob killed four horse-thieves—members of thei Rio Grande gang—near Dolores,
Tex., on'theSoth.
SIRS. C. T. Bubke committed suicide at
Dallas, Tex., onthe 26th,, because she learned
that her husband,was traveling around the
State with another woman.
A powder-mhx exploded at Wairen,
Me., on the 25th, causing a damage of about
$10,000!fi Samuel Mank,, at .work in the
building; was*blown 400 feet and instantly
killed.
An engine boiler exploded at Greeasburg,
Ky., on the 26th, killing one man and seriously woundingseveraPother's. '■'-■■'
William L. Swan, the ^son of a retired
millionaire at Oyster Bay, L. I., notwithstanding jarental opposition, has married
Miss Belle:Thurston, the daughter of a poor
shoemaker.'' The father has threatened to
disinherit his son.
A maker of fire-works at St. Louis,
named Walker, recently committed suicide
by blowing himse-lf up with a cannon bomb
to which a slow fuse was attached.
The extensile packinghouse .of" J..'C.
Hately, at the Union Stock-Yards, near
Chicago, with a large amount; of- product,
was destroyed by fire on the night ofthe
26th. The loss was estimated at $750,000.
The failure of Jackman &0"Hara, cloak
manufacturers IhiS'ew York, Was announced
on the* -26th. The" suspension was due to
the losses of the .senior partner in 3tock
speculation. Jackman had fled to Europe.
Ixdiax's attacked the town of -Eureka,
New Mexico, on the 26th and massacred all
the citizens, some seventy in number.
At a fire in Cincinnati beneath some
cheap lodgipg, rooms oh the 28th Seven persons were veir}r nearly suffocated, and one
man lost his life by jumping from a fourth-
story window.
Five colored children recently.perished
in a burning house at Carter's Creek, Tenn.
The Standard Coal and JronuGompany,
which has been incorporated at Columbus,
Ohio, states its capital at $75,000,000. Among
its leaders are Oliver Ames and William P*
Hunt,fof'Boston, and Samuel Thomas, of
Columnufe" -"It'Is said the1 cbm'pahy intends
to secure all the property in the Hocking
Valley region which can be purchased at
reasonable figures. The most, prominent
blast furnaces have been purchU'recl, and
options have been obtained on the Peter
Hayden and Longstreet mines.
It was stated on the 27th that water had
become so scarce in tbe anthracite region of
Pennsylvania that it had been sold at twenty-five cents per barrel. The out-put of
coal had been greatly interfered with. -
IN 2Jew York City on the *27th, while the
Superintendent of the Brush Electric Light
Compaft"y, with a gang of men, was preparing to lest four lamps on a pole 150 feet
high, in Union Square, that were destined
to illuminate the park, the hoisting gear at
the top of the pole broke just as the lamps
reached the top*. The lamps and their cai>
riage, a heavy mass of wire weighing over
six hundred pounds, fell with crushing
weight from the height, more than one
hundred feet, on a platform, twenty-five
feet from the ground, upon, which, five men
were tending the hoisting apparatus. Three
men were killed, and two seriously hurt.
A conflagration on; the flats in Cleveland on the evening of the 28th burned the
platiing-rnill of Hempy & Co., valued at
$«0,000, and thirty cars partially tilled With
freights: £5%^;/;. .:'/■ ,> "i ' ■ " ■,- >*
A H^RiiieMjs prevailed along the Atlantic coast on the 27th. At Charleston, S. C„
a loss of $140,000 occurred and a son of
Chancellor Lesesu^wMsweptlroiia the seawall, and three colored persons were
drowned at Sullivan's Islaod.
It is stated that Maud S.'will make no
further attempt this season to reduce her
Rochester record.
Personal and Political.
In their/State Convention at .Elmira on
the 24th the j*ew Yoi-k Greenbackers reaffirmed the resolutions adopted.at the Chicago National Convention in IS80. They also
resolved that all money paid to railroad
companies for transporting p.ersons.,or prop?
erty in excess of what is required to pay the
legitimate expenses of operating„such roads
and a fair return, on their actual cost is in
violation of the fundamental law of public
use.which allows railroads to be built, and
should immediately be prohibited by legis-;
lative enactment; that railroad companies
should be prohibited by law from charging more for transporting property during the season when Water navigation is
closed than ■ they charge for like services
during the-season of x>pen water navigation,
and that "we work for the lawful suppression of any traffic or custom that encourages
crime." A 'resolution was also adopted
sympathizing with the President, denouncing the act "of the assassin, and declaring it
the result of the spoils system. Nominations were made as follows: For Secretary
of State, Epictus Howe; Comptroller, John
Hooker; Attorney-General, Dennis C.
Fealey; Treasurer, Allen G.. Woods; Surgeon-General, J. H. Gould; Associate
Judge of the Court of Appeals, L. C. Mc-
Paflan. <-
The recent search forthe. remains of the
late A- T. Stewart proye*d; fruitless, like its
predecessors.
A WashingtOjS- special of the 25th says
Guiteau was reported to be crouching in his
celt in the jail in mortal fear. He would not
come; out. He was afraid to pass the cells'
of |he other prisoners, for fear that in some
way they might manage to kill him. He
even feared personal violence at the hands
of the guards.' In some manner the news of
the Presidentj^Oxtremeganger had reached,
him, and he fully expected in some
way to meet a violent death at the hands of
some one who would avenge the shooting of
the President. He had no thought but for
his personal safety, and dreaded the approach even of the harmless attendant who
brought him his meals.
Colonel J. G." Benton, commandant at
the Springfield (Mass. )* Arsenal, died a few
days ago.
The Mississippi Greenback and Independent Republican State Conventions were
held at Jackson on the 24th and 25th. About
thirty of the delegates were colored men. A
Fusion ticket was nominated, as follows:
For Governor, Ben. King; Lieutenant-Governor, J. B. Yellowly; Secretary of State,
J. J. Shellmau (colored) ; Treasurer, W. H.
Bynuni; Auditor, A. T. Wimberly; Attorney-General, W. F. Fitzgerald; Superintendent of Education? W. D. House. At a
joint mass-meeting on the evening of the
2oth, presided over by John R. Lynch (colored), the nominees made addresses.
THps Yorktown Centennial Commission
and the citizens of Washington and Baltimore haveidecidedttO; entertain the invited
guests of the Nation in Baltimore on the
ioth.llth and'f2th of October, and in Washr
ington on the f3th, 14th and 15th of the
same month. It is expected that twenty
distinguished guests from France will be
present on the occasions. It is also expected that the French Government will send
over two large, war--vessels with troops.
The ships wilfarrive about the 5tn of October, andthe Centennial Commissioners have
determined to invite the officers to attend,
the various entertainments.
It is stated that on the night ofthe 25th
President Garfield recognized his wife sitting by his bedside, and, addressing her in
a weak and trembling voice, said: '' Crete,
you had better go to your room and get a
little rest." Mrs. Garfield begged to be
permitted to stay a" little longer," Whereupon"
the President remarked that he feared the
time was at hand when they should separate
forever. Mrs. Garfield was severely shaken
by this last remark, but bravely mastered
her feelings and appeared composed.
General Wickham, of Virginia, in a
length}' review of political issues in that
State, declares that" no Republican can vote
for the Readjushers'- candidates, and announces that he is heartily in favor "of the
election of the Democratic nominees, hoping subsequently to resuscitate the Republican organization. , , , . ^*a
The *Gr|nd^ £6dge of Good Templars" "of
the State"bf7New York has recently declared
that the legal prohibition or legal protection
of the liquor traffic is the most important
political ,question now before the American
people. t
The National Prohibition Alliance,
•hroughits President, Rev. H. A. Thompson, D. D., late candidate for "Vice-President on the Prohibition ticket, and the Secretary, Mrs. McClelland Brown, of Pittsburgh, has iss%ied a call f or a National Conference of Prohibitionists in New York City,
September 18 and 19. ,
It s;eems, according to telegrams of the
28th,' that District-Attorney Corkhill was
accredited With a statement that he did not
malce-—viz: that he had knowledge of a conspiracy to kill Guiteau* by slow torture in
the event of the President's death. .What
he did say was that he had been informed of
' the existence of a formidable organization,
the*purpose of which was to make sure that
Guiteliu should not escape punishment, and
which, did not intend that he should ever he
taken to an insane 'asylum alive. Colonel
Corkhill adds: ' *l d$|i't believe a regiment
of soldiers could prevent them from accomplish'fag their purpose." **"
Bu£>LONG A. blOKTO^iaUas Marvin, etc.,
the man accused of having committed the
recent bigamous marriage at Richmond,
Va., and also of hitVing married some ten
other women, besides, swindling about a
score of banks WlEhiR the pa«t few years,
.was taken through Newc^^ork, City on" the
27th, by Detective, Pinkerton, on his way to
Richmond. He put on a highly injured air,
swore he never saw the'aggrieved Richmond
lady, and said it was a case of mistaken
identity. He reached Richmond on the
28th, and was locked up in jail. He was
apparently badly brokeq down, and expressed fears of being lynched.
Three hundred Germans of Leavenworth) Kansas, met on the 28th and rescflved
to place men "at every poll to work against
the Prohibition candidates.
Otway B. Zantzinger, a young merchant of Baltimore, a nephew of Mrs. Admiral Farragut, has been arrested and sent
to St. JLotUs for obtaining under false pretenses; $7,000 worth of Hour.
/\ TpiJ following .correspondence by -cable
Was^ftirnished bySthe tS"tate" Department at
Washington on the 27fch:
London, Auguiltt 27.
James, G. Blaine, Secretary of State, Wasbg
I have just received from ber Majesty, the"
Queen, at Baln-joral, a telegram "in these*
words? ^lamdeepiygrlevedattliesadiiewa
of the last few aays, and would: wish my deep
sympathy to be conveyed to Mrs. Garfield."
J. ft. LoweciL, Minister.
-DEPABTMKlfr' OF STATE, )
Washington, Aujrust 37. f
J. "R. Lowell, Minister, London: '■ «
1 have submitted to Mrs. Garfield your telegram conveying the kindly message from her
Majesty, the Queen. Mrs. Garfield Is constantly at her husband's bedside, and does not
give up alt hope of his recovery. (-Her request
is that you return to the Queen her most sincere thanks, and express her heartfelt a pre-
eiation of the constant interest and tender
sympathy shown by h6r Majesty toward the
President and his family in their deep grief
and most painful suspense.
James G. Blaine,* Secretary. 77
Foreign.
At the recent Spain election the friends of
the Government secured a majority ot 209 in
the Cortes. The Carlists failed to. elect a
single-member.
: A. J. WhItton1, the head of the Department of Weights and Measures in Montreal,
nas become a heavy defaulter, and absconded to the United States.
„ Gekmany has abandoned her intention to
purchase the northeastern coast of Borneo,
on which to establish a colony.
In his manifesto to the. Irish electors of
North Durham, England, Parnell ignores
the Land Mlk and professes the utmost
scorn and hatred for the Liberal Government, which he likens in its treatment of
Ireland to the Russian autocracy.
The,Directors of the Bank of Frnglahd, on
account of the continued shipments of gold
to the United States, have raised the rate of
discounfcto four per cent. '■"* ""..,
A lajtolord with large estates in the
south of Ireland has * offered Tiis tenants a
permanent reduction of twenty-five per cent,
in rents rather than deal with the Land
Court.
The .Bank of France has raised the discount rate to "four per cent, and the Imperial Bank of Germany to five per cent.
The alleged object is to prevent the flow of
specie to the United States. ,
The United States steamer Alliance has;
arrived at Hahimerf est, one ot the extreme
northern ports of Norway, and after obtaining supplies and a pilot, sailed for Spitz-
bergen,
A party of sixty English laborers sailed
for Dublin on the night of the 26th to harvest crops for boycotted farmers.
The bullion withdrawn from the Bank of
England on the 26th for shipment to New
York amounted to £200,000.
Subscriptions have been opened in London to purchase an estate for Michael Davitt,
in Wicklow, to be presented on his release.
The London Times of the 26th, deploring
the probable failure of the harvests in England on account of the continuance of the
rains, says the loss would be reckoned by
millions, and would prove absolute ruin for
many of the farmers.
Prince Krapotkine, a Nihilist, having
been denied asylum in Switzerland, has decided to take refuge in London.
Hefeerman, the honorary Secretary of
the Cork Branch Land League, who was recently imprisoned under the provisions of
the Coercion act: was "released"on the 26th.
Parliament was prorogued by the Queen
on the 27th. In her speech from the throne
she expressed the hope that .complete self-,
government in the Transvaal tvould contribute to the-tranquillity of South Africa,
and that the Irish Land bill might produce
benefits commensurate with the care bestowed upon if.
ON the 2Sth the Geneva (Switzerland) police suppressed a meeting which was to protest against the expulsion of Prince Krapotkine, the Ninilist.
A London telegram of the 28th says an
improvement in the .weather in Great
Britain had inspired the harvest men with
some hope.
The Bank of Ensland has stopped selling
gold bars, and has reduced the price of
French coin, of which it holds nearly £4,-
000,000. The Bank of France doles out gold
very gradually. Nearly 4,000,000 francs in
coin were shipped to New York from Havre
during the week ended on the 27th.
fcATER WEWS.
The improvement in the President-"s condition which began on the 27th continued;
without any interruption up to*the morning?
of the 30th. Ine attending surgeons agreed
on the 29th that the case showed a marked
and decided change for the better, "and a
change which held out a promise of pferma-
nence., The President's attendants' took
even a more sanguine view of the condition,
and manifested a hopefulness which Verged
iipon assured confidence. A slight incision
inthe gland during the morning Was attended withfavorable results. During the
day the President received food of a more
substantial nature, and of a greater quantity, than for many days. His mental faculties were clear, and, acting with his im--
proved condition, aided the work of recovery. While recognizing that the President
was Still in a dangerous condition, Dr. Bliss.
said he felt no hesitation in saying he
thought thei chances were in favor of his recovery. At the evening dressing a pretty-?air";
discharge of healthy pus tookplace from the
parotid swelling, which was perceptibly
diminishing in size. Pulse, 11Q; temperature, 100.5; respiration, 18. In his night
cablegram to Minister Lowell Secretary
Blaine stated that each hour the apprehension of serious danger from blood-poison
was diminishing. Dr. Frank H. Hamilton,
who returned to New York from Washington on the morning of the 29th, js Reported
as expressing confidence that the president
Avas.goingto get welt. Alt 1.130on the .nigra-
ins,, of the 30th the President was resting
Quietly.
At the annual Corn and i§eed Fair held at
Vienna on the 29th it was reported that the
Austrian harvest would yield 1,500,-000 .hundreds bf wheat, 2,000,000 hundreds of rye.
2,000*900 hundreds of harley and **:o0,006
hundreds of oats more than was necessary
for home consumption.
Earnest prayers for the recovery of
President Garfield were offered up in the
Evangelical churches throughout England
and in all the churches throughout this
country on the 27th..
Likutenant B. L. Edes and Lieutenant
Lyman G. Spalding, of the United States
Navy, were killed by the premature explosion of a torpedo on the 29th, at the torpedo
station at Newport, 11. I. The bodies of
both gentlemen were blown to atoms. The
explosion was caused by the accidental
" closing of the circuit." -
Forest fires were raging with great violence in the vicinity of Meadville, Pa., on
the 28th.
IN answer to questions on the 29th Dr.
Reybum is reported as saying: "Si nee the
;PiesidehE's condition has become so *lp%
we have examined his lungs carefully every
day and have always found- them healthy.
.The*.repgrt.that pus", cavities have formed
th'ere^s entirely without foundation." Dr.
"Boynton alsd stated that he made an examination of the President's lungs on the 28th,
-aud found them all right.
THE SICK-ROOM AT WASHINGTON.
Another Crisis in tlie President's Condition Safely Passed—After Hope Sad
Been Almost Abandoned tbe Patient
Rallies, and Hope Once More Takes
the Place of Despondency. .> v
"Washington, August 27.
In the earlier stages of the [president's
case,*when his vitality was still strong, and
whilei changesi" in his condition fromi better
to worse and from" worse to better corresponded with the ebb andfloyv pt the surgical'fever, it was noticeable thatthe low tide
of physical condition came in gthe evening
and the high tide-bl improvement rin the
early morning. The febrile rise was then
the most prominent; feature, of * the. case,
and as this, periodical increase ofTfe\re?;-jvas ,
largely due and caused MydiMurbances^ 7ex-7
citement, the heat and the surgical manipulations ofthe day,, it .reached-its culmination in the evening. ^During" the night the
absence of all exciting and "disturhiht influences) and the rest and refreshment oi
sleep, caused. a,gradual improvement in the
patient's symptoms, and his condition
touched its most'f aVbrable point in the early
morning. -Since, however; the manifestationsj of fever;^ ,^e(»me; 7, secondary ^in'
importance to "the " 'manifestations of
exhaustion, the high and^ low tides of condition', if they may be* ^so called, have so far
as time is considered been exactly reversed.
The patient enow -seems t^havet his worst
hours In Tthej .e"&rly-morning and* his "hest7
hours; |ri litig |afteriio>n and evening. ^TSi"" ]
system sinks during the night and rallies in
the early part of the day. This flagging of
all the President's jyitaL seuergiesrin the
morning was especially" noticeable to-day.
Betwperi four and seven a. in. his pulse
was high and *feeble*?hjs7jment.al^C^xditiffh
rather despondent,* arid "all his "symptoms
discopaging. Most of the members of the
Cabinet were at.-,. the^^^ecutiye; ;Man-
sion ; at an early hour, and the fact
that* they did npjj, leave aftergfte appearance
ofthe morningfbuhetin waS^ one'pf the many-
indications Stbathbthithey' and,the surgeons:
felt the grayest apprehensions. The bulletin was of a meager and rather unsatisfactory character^ but it clearly indicated; ^a
change for the worse, and all information
obtainable unofficially frpm the surgeons
was fully in correspondence *"*vitQ-it' Sobn
after the morning examination, however,
the patient rallied slightly, the range of:his-
pulse; became lower, -a faint improvement
was apparent in its tone; and before noon
the urgent alarm of the early morning began
to subside. About noon most of the Cabinet
officeis left the "Executive ""MafiSiOH", feeling
assured that even at tbe worst death was
not imminent. .The'President's condition-
at noon, as described by several of the attending surgeons, was substantially as
follows: Inthe'first.place, hiCfexhaustion-'
had become a very threatening and dangerous feature of the case. His stomach, enfeebled by the poisoned conditiQn'*of the
blood, seemed unable to properly and completely assimilate the food given it, and the
.result was a steady and; unmistakable fail/
ure of all the vital powers, indicated by a
higher, feebler and more fluctuating pulse,
a less satisfactory condition of 4he- wound,
•and untilto-day a considerable degree of
mental disturbance. Th« condition of the
swoollen parotid gland, had hot; changed "in
any respect for the"bettef* There had been a
slight discharge of pus both from the incision made several daysr ago and from the
orifice of the ear, but ite 7 quantity was
not sufficient to relieve the inflammation or
diminish the size of the swelling. The gland
contihued, therefore, to exert a depressing
and dangerous influence upon "the patient's
already weakened vitality, and there wasno
prospect of any immediate change for the
better in its character. The process of repair along the track of the hah" had ceased,
and the granulations were'becoming noticeably less perfect. The pus discharged
by the wound was also unnatural in -ap-.
pearance and consistency. All these unfavorable symptoms were due directly
or indirectly 'to the vitiated condition
of the* blood. In the opinion of the
surgeons the danger of death from exhaustion might be avoided, .were it not for the
condition of the gland," but it seemed very
doubtful whether the process of repair could
begin* or go on in the presence of that complication. Such in-brief'were the unfavorable features'ofthe. President's'cafe at noon.
The Onjy ifaVbrable symptoms were the continued ^ability of the ^stomach* to take and-
retain food, and a clearer and more perfect
action of the brain. Soon after noon ,the
President's attendants reported a, slight improvement in his condition. ' At two pir hi.'
Colonel Rockwell sent the following telegram "toTKf ^^Robei'.tsQn, -New-York:
"At fhi^hourJCt^g o'clock)the*President
is quite"comfbrtable. His pulse**is 114. He
voluntarily remarked that he felt stronger
years ago
always the unexpected that was happening
withbim.''' , - ,. - - ,..,,,.
Later in-the* afternoon the surgeons-admitted that some of the President's symptoms were more encouraging. His .pulse
began to show greater steadiness and a
slightly improved quality, and his mental
faculties were clearer and more active .than
at any time during the* past week. * Both
these symptoms were-taken as indications of
Improved nutrition. The President himself
voluntarily said several times!, in the course
6f the afternoon to his attendants thatj he;
thought he felt btetter than (he did 3'esterday,
and remarked that for the first time in sever! days he found himself able to taste the
food Which he swallowed. The 6:30 official
bulletin showed a slightamelioration of the
patient's symptoms, and. although the
change was too trifling to justify .any great
amount of * encouragement, it Was eagerly
Accepted by those, who, .could not bring
themselves "to believe that' thePresident
would" die, as ground for renewed hope.
Dr. BJiss,in conversation with the Rev. Dr.
Powers, pastor of *Prftsident , Garfield's!
church,1 Said "about. seven f o.'clock ■ thatutlie;
Presidentiadhad thus faij rather a bettei;
day thatf ws«'ahticipat*edthis inorhihg: k--"H&
did o6t think there was enough change,
however, as yet to justify any anticipations
of recovery-or to modify, the views'enter-
tained;by himself and the other suigeons as
to the [extreme gravity of the crisis. "If,"
he said, "the President; gets ?thr,ough rto-
morrow as well as:' he has to-day, Ithink
there will be some ground for encouragement.'*' r.. . •■;■ •* ■>-■ :*•• '„ V
August 28.
Last evening, after seeing the President
comfortably settled for the night, Dr. Bliss
went to the surgeons' room and threw himself on a couch to get a/little rest; but he
found It impossible to sleep without first
satisfying himself with regard to, the extent
and significance of the patient's* recent improvement. About two o'clock one of the
attendants called him and said- the President was awake. Upon going into the sickroom he found the slightly improved'condition of the afternoon fully maintained. The
patient o seemed ^cheerful aM better^ his
mind Was p^'erfeetiylcle^
steady^at about lti'.* f fie" regular" watich'es*
taken Iby General Swaim, Colonel Rockwell, Dr. Edson and Dr. Boyntqu were
not maintained during the night, for the*
reason that these attendants were all too
anxious to 8leep,arfd'Abric^iihem^vere' v^ilf-
ing to be absent for any treat length of time
from thelIcKrc'«,mv"»T'iey were all present
together, therefore, during most of the
•night.; About five o'clock the President
was again sponged all over with alcohol and
water, and seemed to be greatly refreshed.
His pulse had fallen to 102. He rested
quietly during the remainder of the early
morning, and at 8:30 on examination his
pulse Tvas found to be 100, with temperature
and respiration normal. .
Mrs; Garfield,* encouraged by the President's* evident improvement late Saturday
evening, and, wearied by previous watching, Aventjo bed before midnight and slept
most to'f the highti She Was -in the sickroom [again at five in the morning and sat
for awhile by her husband's bedside fanning him; , ' ".-..■
After the appearance of the morning bulletin, Dr. Bliss came, out* of the surgeons'
room again and,.said the President's symptoms iweire very favorable arid inqicate'd „he
OTas in the way of recovery. , Too much encouragement,* however, Should not, he
thought, be drawn from -the present favor-,
able condition, because itiwas hot yet certain itj would b&permanent. r 7
Dr.' Hamilton, who came out shortly
rafterward, said' the patient's symptoms
'showed marked improvement. '
-. Dr. Boynton, being asked whether he felt
encouraged, replied: ''I feel not only encouraged, but very much encouraged."
•"General' Swaihi, in" answer to the_same
questipn, said: "I have been depending
on Garfield's pluck now for twenty-five
years,;and I tell youhe ingoing to get well."'
Colonel Gorbintelegraphed afriend; "Dr.
Hamilton says ..we are afloat and off the
breakers." " .'-,." . ■..,'
Although ta<5 president's pulse and tem-
Seirature rose slightly.during the afternoon,
e continued,to do jvell, and at five General
Swaim telegraphed a friend: " The improvement in the President's" c6hd*itiOn"*is "still
maintained*. All are hopeful, some confident."* """•"■" ; " "
About the middle of the afternoon the
President expressed, a. desire to .see his.
daughter Mollie,* arid when" she enfered the
room and came to his bedside* he took her
hand and asked hfec.about ."her.: health.- She
replied she was-well, and inquired how he
himself felt. *He7 said "I am better. Ask
your mother if the boys cannot come" in."
Soon Sf tSrward ijaihes "came to the bedside
>nd*„was greeted by his father affectionately.
"The President's pulse; however, pegan to
tise; with7 the.» exfiit'ement and emotion
of this interview with his. children, audit
was thought .best hot to allow Harry to see*
him. _»;**- ...*'* ? =
During the evening the Presijdent nested
quietlyi and his fever oy, eleven o'clo.ckhad
subsided. 7 7 7
■" Df. -Boynton at half-past nine thia eVen-
ing gave the following statement of the
present aspect of the President's case: "In
my. opinion all the patient's symptoms tonight show a marked improvement. In the
first place, his mind, which was for a week
more or less-affected by the vitiated and impoverished- condition of his blood, is now
perfectly- clear and active. Up to Friday
night or Saturday morning I don't think
his will-power' had had for six .01
seven- tlays any sustainining influence
upon "his:' body. He had' no strong
wiil-pxnyer." Since yesterday morning,
however, there, has been in this respect p
"n,qt|ceable change. Not only is he more
"clieVrfur and hopeful, but his Will has recovered its-power of sustained effort, and it
is now co-operating, withi all his vital energies in the struggle of his whole Tieing for
life. The condition of his stomach, so fat
as ability to take food is concerned, contin-
.ues good, and. I think there" is a'further
slight improyement'In the processes of assimilation and nutrition. . He has swallowed
to-day more than thirty ounces of liquid
nourishment, consisting chiefly of beef
juice, j peptonized ihiltc, and milk porridge,
and hasJiad*; in.'additionrtwonutritive ene-
^mata. .This.- supply of food is entirely ade-
'quate, if property Assimilated." . •
'•■" Dr. Raybum said at a late hour^to-hight:
■"'The hobes of 'yesterday haA'c, t think,
been fully'realized, arid" I Tfeel greatly encouraged. The appearance of the patient's
wound is„better. Granulation more perfect,
and the Jus discharged less -watery. The
gland 3ias not changed a great deal: I think
by to-morrow•mbrriiilg"lt, will "be ready for
pricking in another place, at lea3t such are
the indications now. It is dischargiug'freely
from all openings, and, although it has not
decreased much in;size,-its tension is somewhat relieved. Not a single feature of the
case has grown worse to-day, and the general condition shows a marked Improvement.-" '".'."
,i . -■—■—< . » .
Hope and Tear.
The violent alternations of hope and fear
throughrwhich the people have passed during the.lasteight weeks constitute an unexampled episode not only in the history of
this country, bu,t inthe history of the world.
Indeed, such an episode could not occur in
any other country, because in no other
coiintryis there such universality of respect
and love for the political Institutions thereof.
.As every citizen of theUnited States is part
^andparcel of the Government, a vicipus blow
aimed at the heart of the Chief JExecutive
of the Nation wounds every "citizen. Every
citizen resents itas a personal indignity, and
everv citizen is touched with sympathy for
the suiferings of the chosenhead of the Gov-
ernmerit of vvhich he. is part. Hence in
-every household in thelarid the cloud of sorrow Which hangs heavily, over the TEx-
„eeutive Mansion is reflected. * Under these
"circumstances, the extreme tenderness
which has characterized the sentiments of
the whole people toward President Garfield
and tbe members of his family in their
great "affliction is-hiost appropriate, most
creditable." 'It is a new revelation of patriotism-, and an assurance that neither the
strife of politics nor the greed of gain has
availed to harden the heart of the
American people. In a great emergency
patriotism emerges from the shadow of factional and partisan controversies, and greetings of, universal good-fellowship are heartily exchanged. A great sorro\v4has?beenpotent to unite a- great people.' If
the ray of hope of tlie President's
recoveiy is destined to be .--. dispelled, and the gfreat man finally sinksf
away to rest; there is no nook or corner of
the lahd^vhere he, will not ;be:mourned, no
place in the Nation where, his memory will
not beitenderly revejed.. Onthe otherliand,
if the, ray of hope shall expand into the sunshine of full assurance of the President's
reebveryj there \yill rise to> Heaven one universal acclaim "of thanksgiving.^-'Chicago
Tribune, Autjust 29.
— . ♦■
—A* miner discovered" recently on
the divide between the Kio Hondo and
the "Riotpoloradoj New Mexicoj a-cave
which] has from time 'immenlofial supplied the Indians with their bright red
war pjiint. Itis believed: to5-he'^Oxide
ofiroii, aud has been located for its
mineral. ,
--T111846 William L. Scott, of Erie,
Pa., was a page in Congress. General
Charles M. Reed, Member of Congress
from Erie, took him home and gave
him employment at woigliing coal. Mr.
Scott's fortune is now estimated at $4,-
000,000.
— • «• . , ..,...„.
—Its is said that some stoues taken
from the artesian well now being bored
in Westminster, Md.-, have been tested,
and gaye a yield of over $600 gold per
ftoriu 7 irhe.jroclcs; were.-gxtttetf^at:a*depth'
of about five hundred"feet. J
MICHIGAN STATE NEWS.
A recent sale .of pine lands in Gladwin
County, about 15,000 acres, has been effected, at prices aggregating nearly "1500,000.
The .widow of Charles Schroeder, who
died recently in Bay City, will receive $8,000
of insurance upon her husband's life.
Mrs. Governor Jerome had an attack of
neuralgia of the heart while on the street at
Saginaw City a few days since.
The great hue and cry raised by the students ot the Agricultural College, which
has led to the resignation of Mr. Fox, the
Steward,. was boiled down by the State
Board of Agriculture to the discovery of a
shortage of $182.20,* and' even that was not
the work of dishonesty, but only the result
of a lax system.* • ■ ' .
Only five women in the United States are
on record, as bankers or bank officers, and
one of these is In Michigan. The cashier
of Browne & Combs' bank at Middievilie,
Barry County, is Miss Jennie Combs.
A child of 'Sandy Marshall, of Farwell,
recently died from scalds resulting from
tippiHg a cup* of tea over upon itself.
At Charlotte .on the 22d Ma3rorAmesH.
Munson was thrown from his carriage down
a street embankment*. The horse took
fright at the cars, ran away, and completely
demolished the conveyance. The Mayor is
quite old and heavy, and the fall injured
-him internally an d broke his arm. The effects may prove fatal.
Shortly after two o'clock onthe afternoon
of the 22d a boiler in Howes' planing-millin
"West Bay City exploded with terrible force.
The engine and boiler were completely demolished, pieces landing one hundred and
fifty feet distant. The body of Jaines Keal-
ey~j "contraptor and resident "of Bay City, was
found lying on* Ms back, black and- alinpst
'unrecogmzafele. "VYilliam Abrams, tji^ engineer, was blown literally ,into pieces, his
arms ;and legs being fifty feet apart; A
young lady. hanie*d Graft, who was walking
near the mill, was biownjuto the river,-<but
was rescued. Edward .Furnemon, was, terribly scalded about the face and body-
A-brams came to Bay City from Cqseville,
and Kealey leaves a wifeand child, afcpres-
ent visiting at Oswego, ;2*"". Y,. The boiler
was an old one and should have been condemned long ago.
Charles "Volberg, a Swede employed by
explorers in digging test-pits on property a
few miles West of Ishpeniing, was buried
beneath a fall of ground on the afternoon of
the.22d. Before the other laborers could
reach him he was dead. About four or five
tons of sand fell oh him.
On the morning of the 24th a Avesterri-
hound freight left part of its cars On the
track east of Portland, on the Detroit, Lansing & Northern Railroad, while side-tracking the other portion of it, and while in this
position* another train ran into the portion
left on the main track, smashingtwenty-two
cars and one engine. The damage was very
great. No lives were lost. .
—The Carson Appeal solemnly affirms
that 4 Nevada florist has a snri'lqw«r
whichlis iiteen inches in diameter, or
^•arlySfour^feetincircumfei-ence.*" ^
—The Grand Union Hotel at Saratoga
had 1,199 gtiests in oiie day rfebenttyl
* ItOws of ^General Interest;
Subjects FOit DtssEOTiON.
ActNq. 16,- section 1, proyides that'the
Boards of Health, Common Councils, Trustees, or executive officers of any city, village; ' or township, the' Sheriff, Coroner,'
keeper of any jail 6icprisoli,-Superintendeht*
'or mauagerslof any charitable., or- .penal in-
■ stltution, maintained in whole or part ^t-
public expense, having in his or their possession Or control the dead body of any
person, not claimed by any^ relative or legal
representative, and -which may need to be
buried, at public expense, shall' deliver such
dead body within thirty-six hours, after
death, or after he or they shall become possessed thereof, to the express or railway
company at the nearest station, placed in a.
coffin, etc., and. directed to the '''Demonstrator of Anatomy of the University of
Michigan, Ann Arbor," except only dead
bodies of such persons as have died from
some infectious disease.
Section 2 provides that the bodies so delivered or shipped shall be used for the ad-,
vancement of anatomical science in the
State at the following Institutions of learning
only: The University of Michigan, Detroit
Medical College and Michigan College of
Medicine, in proportion to the number of
Students in actual ^attendance. Each institution shall pay quarterly Its ratable portion of the expense. ;.-'-'•■
The Demonstrator of Anatomy, upon the
receipt of every such body, shall immediately notify the relatives bf such deceased
person, if known, of the receipt of such
body, either by mail * i>r telegraph, and that
said body Avill tbe,preserved intact for ten
days, during which time such relative will
be entititled.to Said body for the purpose of
private interment upon payment of expenses already incurred.
A^IMAiLS KUISNIjSG AT LARGlil.
Act No. 13, Section 1, provides; that it
shall"not be lawful for any cattle, horses,
sheep Or swine to run at large in any public
highway in this State ^provided, this act
• shall be inoperative only*1 in those counties
or parts of counties in which it shall be so
determined by .resolution passed by the
Board 'of Supervisors of such county. This
section shall jiot abridge the j>oxy.ers reserved to the people of a township in Section 4, Chapter 12, compiled laws of 1ST1.
Section 2*proVides that In case the Board
of Supervisors in any county shah pass a
resolution.allo.wiug any of .the, classes of animals named iri Section 1 to run at large In
such county, the said section shall be null
and void. , .-. ,-■■■■.
UXCl,AIJIli"i MONEYS.
Act No. 86 provides that when any adinin-
istrator or e^ecuto/,shall have made final
settlement with the J^robate Court, it shall
be the duty of tfie Court to order said administrator or executor: to Jdeposit-with' the
County'Treasurer such monejrs* as he may
have belonging to any non-resident or unknown heir or claimant, whose Whereabouts
after diligent inquiry he cannot ascertain,
taking his receipt therefor; and upon filing
his receipt in the Probate Court, he shall
be entitled to an order discharging him and'
his bond, the same as though he had paid
his money to the heir or claimant. This act
furthers provides for the pr'opeir keeping,
etc., of said money by the County Treas-
^GltBEK'jS TOWKSHIP XAWS.
Act No. 123 provides thatthe Secretary of
State shall, as soon as the same can be prepared, etc., supply,, one,, copy of Green's
i" Treatise on Townships and the powers
and duties of Township Officers" to each of
the, several Supervisors, Township ClerkS,,
Com'mijsioners of. Highways, , Township
Drain Commissioners^ and to each of the
Justices of theJPeace in the several tbwn-
ships in this State. i-The; S,§yeral officers re-
jCeiying s,(iid bopk are required by this act to
deliver the same to their successors in office.
The cost is not to exceed $150 percopy,
and all acts of the late session affecting
townships are to be included.
I-TOaSXFORFEITABLE MFE INSURANCE,
Act No. 154 provides that no policy of Insurance on life, issued after this act shall
take effect, by any company organized under
the laws of this State, shall become forfeited or void by the non-payment of any premium thereon, after the third, any further
than as follows: •
The net value of the policy, when the premium becomes due and is not paid, shall be
ascertained according to the '' American ■
experience table" rate of mortality, with.,
Interest at four per cent, per annum. A
Surrender charge aud indebtedness on policy, If any, shall first be deducted from such
netvalue as iu said act provided, when the
remainder shall be considered a net single -
premium of whole life non-participatlug
insurance, and the amount it will insure
shall be determined according to the age of
the party at the time when the unpaid premium became due, and the assumptions
aforesaid In regard to rateof interest and
table of mortality.
ADTTI/TEKATIO^ OP FOOD, DBESTKS, ETC.
Act No. 254 provides that ho person shall
mix, color, stain or powder, or order or permit any other person to do so, with any ingredient or material, so as fo render the
article injurious to health, with intent that
the same may be sold; and no person shall
sell or oifer for sale any article mixed, colored, stained or powdered, as aforesaid; nor
shall any'person mix, color, stain or powder airy article of food, drink or" medicine,
or which enters into' the composition thereof, with any other material, whether injurious to health or not, for the purpose of gain
or profit; or sell or offer the same for sale,
unless under its true and appropriate nariie,
with notice thatthe'* sanie Is" Sfllxe'dOr'Impure-marked or printed upon "each papk- ■*
age, roll, parcel or yessel containing the
'same, so as tobe and remain at all times
readily visible. .■■•"-..'.'■ '■ "
"No person shall mix any glucose or^rape
sugar with sirup, honey;or sugar, intended
for human food, nor any oleomargarine,
suine or beef fat, lard or any other foreign
substance, with any butter or cheese intended for human food, without distinctly
marking or labeling the article or package
containing the same, with the true and appropriate name of such article, and the percentage In which glucose, etc., enter Into
its composition; nor shall any person sell or
offer foi- sale, or order or permit to be sold,
any .such article or mixture, 'without at the
same time Informing the buyer of the fact,
and tbe proportions in which glucose or
grape sugar, oleomargarine or suine fat has
entered Into its composition.
Any one violating the provisions of this
act may he punished by fine or Imprisonment. '
REPORTS OP CEUUNAI, PKOCEEMSTGS.
Act No. 205 provides that within ten days
after the final disposition of any criminal or
other proceedings before any Justice of the
Peace, to which the people of this State are
a party, or wherein the county maybe liable
for any costs> it shall be the duty of the
Justices before whom such proceedings
shall be had to make aTeport of the'same to
the Prosecuting Attorney of the County;
The report must contain the title of the
case, the date of filldg'tfie-'bomplaiht, the
offense charged, the plga, the names'of at-
''tofneys, the date ot trial, the verdict or
fiiiding, the judgment, etc. TThe Prosecuting, Attorney shall, immediately after making his animal report to the Attorney-General, file said reports of Justices with the
County ClerK.
This act also directs the manner in which
the jurors and witnesses shall be paid, and
provides a penalty for the refusal or-neglect
ofthe Justice to make the report as herein
provided. . . . •
^ ^ — ^
TJrte Equalized Real aud. Personal Estate of Mlclugau.
The following statement shows the population of Michigan for 1880, the number of
acres of land assessed in 1881, and the aggregate of real and personal estate as equalized by the State Board of Equalization for
1881:
1. '-
K
*&$'
"3A'8,&%
o
-^3"
c&
*■<
' of
° = S*S*s
COUNTIES.
^ -
V3 .
* *
—-««'•■ =
-••P'g-^-SQ'SV
ft.
Q
r+i
*^
. .^...--.
ff
Alcona......
Alleg*iui.....
Alpena.—.
Antrim
Baraga
Barry ...
Bay..........
Benzie..
Berrien.,..,
Branch......
Calhoun.....
Cass.
Charlevoix..
Cheboygan-
Chippewa. .-
Clare
Clinton.
Crawford....
Delta.
Eaton...
Emmet ,
Genesee ....
Gladwin
G. Traverse
Gratiot......
Hillsdale....
Houghton..
Huron.,
Ingham ....
Ionia..
Iosco
Isabella......
IsleBoyal...
Jackson..,.,
Kalamazoo,
Kalkaska....
Kent..... ...
Keweenaw..
Lake,... ....
iapeer. .
Leelauaw—
Lenawee,.,
Livingston..
Mackinac..
Macomb
Manistee... .
Mauitou
"Marquette..
Mason —..
Mecosta.....
Menominee.
Midland.
Missaukee..
Monroe ... .
Montcalm...
Montm'r'cy.
Muskegon..
Newaygo...
Oakland .
Oceana.
<)gemaw-...-
Ontonagon..
Osceola..-.. -
Oscoda......
Otsego— ..
Ottawa
Presque Isle
Boscommon
Saginaw-...-i
Sanilac., ;
Scnoolcraft.i
Shiawassee-•
St. Clair.....
Sfc Joseph...
Tuscola
Van Buren,,
AYashtenaw.
AVayiie......
"Wexfora.....
3,107!
37,S0S?
8,769;
5,357)
l,8.1it
%>,m
•J8,08l|
36,780
27,94J.
38,i>2!
3-.',00S!
5,114!
C,5:Jl:
5,243;
4,187,
37,5 4
1,15J|
G,m.
.31,333!
6,U43i
89,21!)'
l,lf
;33,72-j|
33,473'
;»,089
83,677
33,873
6,8.3
13,159
366,497.48
516,13iJ.00j
, 379,24-2,601
280,658.931
381,531-31i
352,302.33
4S6,970.43i
lS0,b29 45'.
352,489^01
315,483.01
41.0,710,00;
310,5^9.00
^^.ofl-Oa.
416,744.33!
505,28.3.1.0'
3.9,20173;
36:,235.53
252,7.53.00;
No rep't
55S,808.58
191,714.00
403,015.03,
'8.0..,91*t.l9.
379,598.79;
357,607.00
375;9U.00f
HI ,710.75!
510,S.Jl.ll!
843,3-33.57!
361,504.*-3;
245,870.47
354,-086.79!
55 NO report.
43,031 431,641.60
34,342 349,7*-'3.«0
2,937 > 3-bD-.705.53;
73,252t 5*3'885.00:
4370 203,570.3;3.'
3,233 1344,243.03
30,138 413,89-iOO
6,253 183,231.78.
48 313 463,836.03.
23,251 *«-62,262.00
3,903 393,151.331
31,627i 29-i,055.00'
12,5*3:3! 312,l^34.Wi
1V3 4 Ifo report.
35,39,3. 1,503,7;>3.11>
lu,l.63 285,842.93
13,973! 343,773.00;
31.988' 733,6*i4.-14i
6,894s 323.2'6.93,
l,5"33i 326,999.86
33,623i 251,314.00
33,148j 446,5l7.(h)
;g. 339.347.20
2(3,586 ' 379.236.3J
14,688 537,704.00,
41,837 *510,53.'.00,
11,699 333,316.39}
1,914 319,190.03,
-2565 ;*739,€09.39.
10,777 S59,177.00j
467 * 320,637.60
1,974 302,486.001
33.135; 341,608.49
3,113 364,910.34!
1,4597 378,033.63;
59,095! ;507,549.03
23,341' 595,743.611
1,575' 725,125.41
27,059 336,715.3 V
46,197: 432.46t.e0:
36,636. 313,305.00
35,739; 501,009.00:
30,807i ,384.*684,31i
41,848 431,49-3.19;
166,426 '368,4]5.00'
6t815 336,753.80
§3,500,000 00
13,500,000 00 *
5,10J,000-;00 *
2,530,000 00
3^00,00J 00
13,100,000 00
18,00*0,000 00
l,50i!,000 00
15,030,000.00
17,500,000 00
2i,50),000 00
i%50o,ojo m.
'2,00 ,030 00
" 3,000,000 00
3,000,000 00
3,500,000 00
16,000,000 00
1,300,000 00
2 500,003 00
16,000,030 00,
3,000,030 00
3l,0Q0,iiOO;0O»
1,3-30,003 00
3,003,003 00
7,000 000 00*
3l,ODOvOOO"00-
3,500,000 00-
SiO^OOO-OO
16,'J 0,000 00
16,0.0.003 00
2,0s)0i0j0 00
4,000,000 00
100,0*0 00
27,000,000 00
• 33,000.003 m
2,5t0 030 00
;33iOGO,O0O 00
4:03,000 00
t; 3,003,030'0D
•13,000,000,00 '
1,000,003 00
27,500,000 00
15,000,000.00
3,500,000 00
15,100,000 00
3,51)3,000 00
253,000 00
-5,000,000 00
3,0.0,000 00
3,500,000 00
2,500,000 00
3,000,000 00
1,800,000 00
16,000,000 00
9,500,000 00
1,250,000 00
6,500,000 00
4,000,000;00
26,250,000 00
3,C00,000 -00
1,500,000 03
3,003,000 00
3,500,000 00
1,000,030 00
1.500,000 00
8,500,000 00
1,350,003 00
1,500.000 00
35,000,000 03
5,003,000 00
2,500,009 00
13.500,000 00
15,000,000 00
18,000,000 00
9,00),000 00
.14,000,000 00
130,000,000 00
130,030,003 CO
3,00;i,0D3 00
;_Tptals... .11,630,335 ^,^,8^2(|fgl0,0gp,Q^^
(ff) Includes Montmorency,
(gg) lucluded ia Alpena,
s^r-i
-±.$h*!m^:*£$tJ£M><tfW&&i!ii
^.^^umvWVi^m.v^ BW*jj|t.]g^wi.*i.V.ji1„.
r
A
^^*rffi"'^ss^SEE"i^^^K^^ar!f
I
A
WB£ilfa>*Tyi fftiVff.CTyn&l j-"T
- ■.. _, Tiit'n^Tiftfi-ffli'iri'' ^-triiTi^riVl^^rf^;
.^■T^t^l^t^T-yf 'ff[lll-lTf f!ll:jlt5^^f ^"ifli^ '"" W" ^ ' ■^f*^*iiqi^f|B^-J'i^,tt|-^^ "• ' "•-* - ■iW.^I l^VylrtN^^t,^^^1h|^^\^t^^y•^^^
*"" 7i;^«*A!*Mr*^*#*^
6
-,»™«__
•a»yig<1*;i'W'»'|'»''«'i
Object Description
| Title | 1881-09-01; Saline Observer |
| Date | 1881-09-01 |
| Publisher | LeBaron & Nissly |
| Description | An issue of the Saline, Michigan newspaper. Published weekly. Began publication in 1880. No longer published. |
| Subject/Keywords | Saline (Mich.) - Newspapers; Washtenaw County (Mich.) - Newspapers; |
| Copyright Permission | This material is in the public domain. |
| Type | Newspaper |
| Format | JPG/JPEG |
| Language | English |
Description
| Title | 1881-09-01; Saline Observer |
| Date | 1881-09-01 |
| Publisher | LeBaron & Nissly |
| Description | An issue of the Saline, Michigan newspaper. Published weekly. Began publication in 1880. No longer published. |
| Subject/Keywords | Saline (Mich.) - Newspapers; Washtenaw County (Mich.) - Newspapers; |
| Copyright Permission | This material is in the public domain. |
| Type | Newspaper |
| Format | JPG/JPEG |
| Language | English |
| Transcript |
? rs" *ftnnap^j iNKI&M,OFiYHH,B^ ICOVEREK OF Jfl! pg COMPOBTO IPosStlre Cnre J Complaint, and Weafc,essA Ir best female population. ^ l^-f ?*? ima°* Peiaa*8 Com. pc-es,isaaininabaa and nip-lr libeeasent^ andthe eonsequeS J is paxncalarlj adapted^gj [expe: tamora fram the uterna f n l^ps-teat. Tha tendencxto can -evestreainess ofthe stoaa^ Jj-oehes, Ifervcras lustration ■jffirssEess, Sepressloa, and Ihai" i=? dawn, causing pain, -nreirfit %pc-npsBssily cured byits •£*. . paerail eirenn-stoee&actin tiat govern the fex-ale systg^ ■yoiaj-Iaists cf either sex this l.ik*S TE6ETABXE COX. it SB aad 23S Western Avenue IbiSboeifisfor^i. Sentbxioaa ■si is. tke farm of lozenges, on Ifccs foreitier. MraPmSam Hc^inqpiry. Send for pamph. . ^.?n.;a.i tsis -Ripen, hrithontLTDIAE. PISEHA3PS furs cccsSpagon, biliousness rtr. £5 eantsuer ba& pH!IE8iC3.,Ciiic8 o,Ili BT DKCSSISTS. jlfij IFUL If " the LITER, ROWELS] 15 at-the saate time. M; &a s?3tem of thepoison- rel-p9 iu Eidaey ar.a Urt- g ;uszeES, uasadaae, Caisti- " . Sbesaatsra, _Tearaigi3, i £2i SKiCe Complaints. "SSOSLESAT: -J »-:::?:i-:a City, Kansas, ''*■ i !:<-; ifter rejalar Phy- 'JSfcrfi1 ar years. v? Washicirt?!!, C'Mo, says I t » d*9 l-y fvar prominent l.e »5es a'Ji-rwards oared by hneili;."!:;, Chorion, Ohio J-j.t-.l t:? ;t-, teh;,r Moated s!.:vy-V.,.:tt-:reili*m. .."tl: Satan, X. T., says ..--'itf fr':::> uiiitsey troubles I;u3 v.aj esjeil by tlie ass of bf J*:-.;k<-rp. Tesn., .-offered f i^iti iJidney troubles and J-e.s or o:-er medicines" J -' '--S-aeiy Center, Vt, t7it?: k.-spt diJBauilj- and Ii.:aney-v7ort isaja mm "*NTLY CURES [EASES, R COMPLAINTS. I and Piles. Bry Testable ?»na in a-1 ^^"-Jit?2^****-^ Quarts SS a ia |
